PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_18.43
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 148aa    MW: 16901.3 Da    PI: 8.2184
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_18.43genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.13.8e-132684563
                                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                       bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                                 ++ +r+++NRe+ArrsR RK++++e L  ++ +L++ N++  ++++  ++ + +++s++
  evm.model.supercontig_18.43 26 RKRKRMISNRESARRSRMRKQKQMEDLIHEASVLQSDNRRIMEKINATTQRYINMESQN 84
                                 5789************************************************9999988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.7E-172286IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.4842487IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.61E-112679No hitNo description
PfamPF001708.7E-112684IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.6E-102677No hitNo description
CDDcd147023.34E-162777No hitNo description
PROSITE patternPS0003602944IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MASVQRQASS GSETTDPRYA SIVDERKRKR MISNRESARR SRMRKQKQME DLIHEASVLQ  60
SDNRRIMEKI NATTQRYINM ESQNNVLRAQ AMELTDRLRS LNSVLQMVED VSGLALDIPE  120
IPDPLLEPWQ LPCPVQPIIA SADMFQC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12546RKRKRMISNRESARRSRMRKQK
23845RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051102.13e-73Basic region/leucine zipper motif 53
SwissprotQ9LZP81e-70BZP53_ARATH; bZIP transcription factor 53
TrEMBLA0A061DR453e-73A0A061DR45_THECC; Basic region/leucine zipper motif 53
STRINGfgenesh2_kg.5__2740__AT3G62420.15e-70(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30362763
Representative plantOGRP5511678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.16e-72basic region/leucine zipper motif 53